PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g07230.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 444aa    MW: 48202 Da    PI: 10.465
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g07230.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP37.18.2e-12398440244
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-T CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCq 44 
                                   C  ++ +adls+ ++yhrr kvCe+h k+ vv+v+g+e  fC 
  Zjn_sc00004.1.g07230.1.am.mk 398 CALDESKADLSNYQDYHRRRKVCETHCKTLVVFVAGREMLFCP 440
                                   999***************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-13390440IPR004333Transcription factor, SBP-box
PROSITE profilePS5114112.964395444IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.94E-11396441IPR004333Transcription factor, SBP-box
PfamPF031109.0E-9398439IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MQKLGRNAAT IRASAATKTP QLNLDPPAAT AAATRTRQCP LNPGQERANS LTCTRAIAAA  60
AIPRRRPTGA IPSHRLAVEP SRHHEMPRRT GWGRQGGGSR DWCWEVWTFL ERSEPPPPRY  120
NAEGGRAAHE LAVAPPHAGL KNTAEEANGI SSPVFTTSSS SARASVLPIS RPPNLRERLG  180
GWSSSGRGEC GGTSLAPRRF LLVERSALLA LDWWVELAAN QSAPVTCPAR EVTAAYPHRR  240
SSIQTHWPAS AREKIIPDAS LWPVGTGRAA EWIWEPENEA AAPRDGGHVR RRRSLFSAPQ  300
PLRDERAKLS RTQAGTRRLL PHSQITDEGG GLESVVTAGG WNVEHGAVWT SRSSGASSTG  360
GPGSADLKLG GVDEYELSDG GRRLARDRQK HGQQCPSCAL DESKADLSNY QDYHRRRKVC  420
ETHCKTLVVF VAGREMLFCP TSPR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3281722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-08squamosa promoter binding protein-like 10